DPCstruct | MC37566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 5 aa |
| Standard deviation of domain lengths | 5.11 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7I8Q6 | 85-184 | LLLVRQSPYIHTLVVREKVSTATVLLLAHTAKNLIYFYVRRNAIMLKADWPYNPDWTPEFYAWLCKNARSYEAMEREVAQILGHRWQ… |
| A0A1Y3BQH7 | 9-111 | IYLSQHCSRLRTIIINDLISTATLLLIVTYARNITKLYVRRNAIRKRFDCLINPSWREHFIKWLRKTSRSYEQTFAEISRMLGYKWI… |
| B7PTP4 | 2-107 | None |
| A0A6V7LMV2 | 1-92 | None |
| A0A815U7Z1 | 537-642 | None |
| A0A3P7VAK6 | 63-157 | None |
| A0A812CKU1 | 310-409 | None |
| A0A336N1Z6 | 35-129 | None |
| A0A820QPQ2 | 277-381 | None |
| A0A3P6IBZ8 | 72-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.