DPCstruct | MC37560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 135 ± 8 aa |
| Standard deviation of domain lengths | 8.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8F6A6 | 1-134 | MMARLLNRGFSLRGALEITRENSTLGDEYLIVGDGSVDIAQTEGGAPSVISLEKYEDSEFGFALQSYSTKEFKLGSVTASLLESVQD… |
| V6DTU9 | 161-284 | LIGLLSAGGSISVATALAIRDEGTQARFIGDPGTLASKNRGFPLQLLSLRSLDTNSLAVDRWSFTSIKAMLGMECSTIVDSLDRRRR… |
| A0A2R6L2C2 | 1-148 | None |
| A0A6A9T687 | 13-145 | None |
| A0A3M9VRU6 | 177-314 | None |
| A0A6G3ZRQ4 | 119-250 | None |
| M0A3H4 | 464-596 | None |
| A0A2R6I2Z9 | 261-408 | None |
| L9USU9 | 724-857 | None |
| M0M4Z6 | 603-724 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.