DPCstruct | MC37559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2167 |
|---|---|
| Mean domain length (aa) | 245 ± 51 aa |
| Standard deviation of domain lengths | 51.06 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.36 |
| Mean intra-cluster sequence similarity (%) | 12.34 |
| Pfam Score | 88.41 |
| Assigned Pfam label(s) | CL0023- PF06675- CL0187- CL0268- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0WUT1 | 8-249 | PLCVLELLGETVEGRDIDLLVVGEPDESKRKIWVVARQHPGEPQSEWFMQGLIERLLDESDPISRSLLSNAVFYLVPNMNIDGSILG… |
| A0A3A8YR03 | 2-177 | KIALTVGHSLLKNGCYTSADGKTYGGCNEYKWCKAFSKQLASALKKNGHKVKRIVCPEKKFTCSTQEKNYKLNLINRSNYNLVIELH… |
| A0A1I8IEA4 | 108-421 | None |
| A0A1I8IPN3 | 223-511 | None |
| D0L773 | 8-225 | None |
| A0A446PYH9 | 361-570 | None |
| A0A814S819 | 24-404 | None |
| A0A1V5UY18 | 23-344 | None |
| A0A814V1Q3 | 359-575 | None |
| L0D5J2 | 228-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.