DPCstruct | MC37556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3H938 | 3-63 | EIWALGLRNPWRISFDPDRGDLFIADVGQNSLEEINVQDAGSGGGENYGWNIMEGSECFAA |
| A0A2D9LV73 | 38-109 | YAIPDDNPFVSNPNARAEIWAYGLRNPWRFSFDPLTGDLWVGDEGQNSFEEIDLVNRGGNYGWNVAERLHCY |
| A0A1W9QAD8 | 325-398 | None |
| A0A150QKT9 | 862-928 | None |
| A0A839E539 | 30-103 | None |
| A0A7J9YXT9 | 207-283 | None |
| A0A2D7NIS0 | 626-709 | None |
| A0A812MXC2 | 150-216 | None |
| A0A538NWV3 | 29-83 | None |
| A0A838R453 | 10-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.