DPCstruct | MC37552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Standard deviation of domain lengths | 13.37 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2GVJ5 | 1-77 | MLIDGKKVACASCIKGHRATHCNHRDRPLVEIKKVGRPSTQCKKCRELRRVRQLHVKCNCNQDALRIQKGRVTDPQT |
| A0A1Y2F4L5 | 1-67 | MVLIDGVKYACHSCVKGHRSSKCTHTTRTLVEIKKKGRPTSQCSHCRDLRKTRAVHGRCDCAARETE |
| A0A4V5NAN4 | 1-67 | None |
| A0A1Q3AGI6 | 1-76 | None |
| A0A1C7N7L9 | 1-72 | None |
| F2DSH9 | 1-83 | None |
| A0A0H2S2R7 | 1-82 | None |
| A0A2P2GYQ2 | 1-69 | None |
| A0A1X2IN78 | 3-127 | None |
| A0A1X2IPJ5 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.