DPCstruct | MC37551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 168 ± 25 aa |
| Standard deviation of domain lengths | 24.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2GV01 | 2-181 | VQKHSDLHHFVPLNLLTGTSRTFSPSEIHQLVALQVYEFCRSRNLVFVWVYLYSNWYTRDQWTLWARSARNAIPAGKTTMMIEAHWR… |
| A0A177SZK3 | 264-444 | ISRHFNEHTSFPTLLGTYLTVDELHRKQAKEAYDICRAKDWARVWAYLWVNWYCKEEWILWARGAGEKIPILKSTMVTESHWRLIKH… |
| A0A0C9U897 | 767-999 | None |
| A0A2V1DDT0 | 426-549 | None |
| A0A2N0QW53 | 113-279 | None |
| A0A397UNI9 | 2-149 | None |
| F8Q9M5 | 103-269 | None |
| A0A372QAT9 | 3-148 | None |
| A0A219AP28 | 495-676 | None |
| A0A2Z6RHJ1 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.