DPCstruct | MC37550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 220 ± 27 aa |
| Standard deviation of domain lengths | 27.17 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08618 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2IN75 | 194-392 | STSGLGVAMSDDSLRSLQYCLTWLRWANGRLGKSIVALHSAVNEWESHKARSASDIEAGGSGQESASLLTQRIQAVKADVLSTLKQV… |
| A0A1X2GSX4 | 30-260 | VAETRQVSSSSTWKQLVAGASTAAGTTAAVLSEESMKCMKYCLSWLQYAIKHIEQQMELIRSYLVSQANHATHALPPSAEGPSPPKL… |
| A0A0S6XDZ3 | 41-302 | None |
| A0A0E9NHK6 | 422-609 | None |
| A0A0F8WPD3 | 1-188 | None |
| A0A0M9VMY3 | 25-231 | None |
| A0A1X0RHU7 | 1-161 | None |
| A0A0M9VRV3 | 236-514 | None |
| I1CJK0 | 217-416 | None |
| A0A3N4ICR0 | 232-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.