DPCstruct | MC3755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 180 ± 23 aa |
| Standard deviation of domain lengths | 22.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y5R8I3 | 43-193 | AISKAGFLSDQDRKLLEEVAKTQNYYAAVAVPPDEGMFSNAAASAANFHRMEDAEVAALATCNDRRNGGAPCEVVLRVYPKGWKPQP… |
| S6HE58 | 168-340 | KGKVNSLVITDKFETFLHKYLQSKDDYKALAIALNNRNGWTASQKTGYLSQQAANYQALQQCSARWRAKGNSGACKLYMMSDQYVYK… |
| A0A1H4MPZ9 | 564-730 | None |
| A0A7C3L435 | 24-208 | None |
| A0A561JDR8 | 116-288 | None |
| A0A6G6WZT5 | 2-162 | None |
| A0A257SS83 | 298-460 | None |
| A0A2T7UAK1 | 374-560 | None |
| A0A7Y7WLY4 | 357-519 | None |
| A0A4Y9L7Z9 | 22-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.