DPCstruct | MC37548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 206 ± 44 aa |
| Standard deviation of domain lengths | 44.44 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 72.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 18.98 |
| Pfam Score | 68.59 |
| Assigned Pfam label(s) | CL0012- PF10406 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2GQC2 | 2-216 | THPASLLYVRKSNEKVVAAIAQQVGFESIEPHALSHLSDLLGTYLERLLTSTHSYAELSNHTRPNYHDITKALLKANADIPELCQYA… |
| A0A1V9XCY2 | 6-210 | HATPYPVYRRVLQAAVSAICLEQGFGSCDATAMETLTEMLQATLTEICHSAKAFAELGGRTEASAPDVCLAVADMGVRLEGMREYIR… |
| A0A6J3CD29 | 2-150 | None |
| A0A5J4Z2K8 | 1-335 | None |
| A0A821H9G0 | 1-171 | None |
| A0A804NSH7 | 1-176 | None |
| B4H611 | 7-234 | None |
| A2DWG6 | 4-198 | None |
| A0A670JAP3 | 2-240 | None |
| T2MB23 | 2-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.