DPCstruct | MC37545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 418 ± 97 aa |
| Standard deviation of domain lengths | 96.67 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0228 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2GM57 | 101-489 | KDLKALALLSEGTSFKCVPHVDQEAVYHHVHDQLRKNQCITIFPEGGSHDRAELLPLKAGVTLMALGAMAKYPDLDVKVVPVGLNYF… |
| A0A7T9FHQ4 | 96-440 | DNVDTITLNKPIFEKTAKILHQQGAILIFPEGNQARLRNIRPLQKGFARMGFGAAELSNFENSIQIVPIGINYTNHTESRGSIFLQA… |
| W2M7B6 | 1-470 | None |
| R1CG03 | 182-770 | None |
| A0A433DK35 | 75-550 | None |
| A0A7S2SXG4 | 135-658 | None |
| A0A4Q4VYT4 | 11-392 | None |
| A0A662XPY5 | 109-488 | None |
| A0A7S3NSF3 | 2-330 | None |
| L8GWS1 | 92-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.