DPCstruct | MC37544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 155 ± 24 aa |
| Standard deviation of domain lengths | 24.27 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2GKX3 | 10-172 | PTWRRHEEKNDPVAISVVVQQRNPMKYGSYPNTAPSSPELTPTFPSENAIDFHALDNSNDKEALENQKVSMTNDVALKFLKAVIFNE… |
| I1BI60 | 154-287 | LDICYKDDPTMPIALCVKSIDQNPYKNKRYHDETTAINQAQLVEFLNTVYLPFDMDNGDLYEPKSLTFNEIFSNVLKITNVLDDKTV… |
| A0A1X2GDH8 | 61-205 | None |
| A0A1X2GLK7 | 3-146 | None |
| A0A1C7MUR1 | 5-150 | None |
| I1CEK9 | 73-245 | None |
| I1CRW2 | 3-154 | None |
| A0A0B7MYQ4 | 12-159 | None |
| A0A1X0RNQ2 | 2-151 | None |
| A0A1X0RT69 | 30-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.