DPCstruct | MC37541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 99 ± 15 aa |
| Standard deviation of domain lengths | 15.38 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I1CK90 | 14-116 | QTRFERFVKGLKMDGFEVFGYARKSPHKLSSEALKKNLQNMITCLRHRSLVEAVYVSPNSLAKSPIVSRDMSNTDEELVQMELDNCA… |
| A0A1X2GDH8 | 209-303 | WPNHKQRIQQLKDDGYLIVGYARKSPGGSNAGRVVCLESMTSLLKDRSLVDKVFASHVCRASDRLSGRDMTATTSQSFQGSDGTSQG… |
| I1CUT8 | 31-102 | None |
| A0A1X2GQ41 | 2-110 | None |
| A0A1X2GSS3 | 19-100 | None |
| A0A1X2GTS1 | 67-143 | None |
| A0A1C7N9M5 | 6-94 | None |
| A0A1X2I156 | 7-92 | None |
| A0A1X2I899 | 66-166 | None |
| I1CRW2 | 160-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.