DPCstruct | MC37540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 433 |
|---|---|
| Mean domain length (aa) | 160 ± 30 aa |
| Standard deviation of domain lengths | 30.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.72 |
| Pfam Score | 99.45 |
| Assigned Pfam label(s) | CL0023- PF08719- CL0387 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2GC42 | 5-160 | YFWGHSKTSEYACFSQWYGSAFKDKEGHTYANAEQYMMYQKAALMGDAVMGTAILAGKNPKAIKAMGRKIKNFDEALWNKHKETIVF… |
| A0A1G6Q9K0 | 7-163 | MTLFFSKEDALSNWHPSNFVVKGVEFNCVEQFMMYCKAKLFSDQVVADLVLKAQHPKDQKALGRRVANYDDRVWSQRREGIVRHGAY… |
| G4TCM7 | 742-987 | None |
| Q5B078 | 471-731 | None |
| A0A7S0ATR8 | 162-334 | None |
| A0A7S4R150 | 39-187 | None |
| S7Q215 | 93-251 | None |
| A0A0K0EFT9 | 271-491 | None |
| A0A1I8I5I5 | 6-157 | None |
| A0A3S2PWB7 | 48-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.