DPCstruct | MC37539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 129 |
|---|---|
| Mean domain length (aa) | 127 ± 21 aa |
| Standard deviation of domain lengths | 20.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 68.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2GAV3 | 8-131 | SSTALPTAVQALDPGIYRPASGGLVTVAPTPAMQEEEPLYVNAKQYHRILRRREARLKLEEMNKAAARSRKPYLHESRHRHAMRRPR… |
| L7JZ20 | 2-75 | NEQPLYVNAHQFNCIRKRKLRRDFLDSITRPKSVNGSGYLHESRHRHAMNRLRAPSGRFLTKEEAKEVRMKERK |
| A0A0S6X8F4 | 153-278 | None |
| A0A1X2I956 | 3-139 | None |
| A0A5B7CB34 | 1-111 | None |
| A0A0A9DAG3 | 27-145 | None |
| A0A317WV87 | 402-523 | None |
| A0A066WE23 | 10-124 | None |
| A0A7S1UL87 | 85-177 | None |
| A0A7S2UPR3 | 175-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.