DPCstruct | MC37534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 186 ± 36 aa |
| Standard deviation of domain lengths | 36.20 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2G583 | 18-218 | TSDKTRIVLGYHSDQRPLTATLPPLSESLNRLASVIINLDPLPASTHHADQHSRLTGFVAQDTFGYLPITANQITRGALARVEWRRK… |
| A0A7J7AID5 | 101-236 | VMHHGFTTMYTTIKNLMSNEGVLRVIAVFHSDLIQDDNVLRYFNHLATMHLTLQPAQRITYTYKKTKKVITQTESYAIESGVLKCEK… |
| J8TZI8 | 403-566 | None |
| A0A0D8XR59 | 18-195 | None |
| N4XEB6 | 1-175 | None |
| A0A397JNY8 | 135-352 | None |
| G4TR07 | 16-176 | None |
| T5A5Q9 | 1-132 | None |
| A0A556TYX6 | 19-146 | None |
| A0A1E3IE60 | 105-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.