DPCstruct | MC3753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 155 ± 13 aa |
| Standard deviation of domain lengths | 13.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 51.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329RRP1 | 363-504 | CPASYDVHSDLGLIDGRGEHHWGVNYNGTCFPVMNSYTGSYLCDPDNTNLKCTSPRNSSTPKSGAMSSFNYQMDAISSNWPLHVGAY… |
| T0S0W9 | 359-515 | VNGDLGLIDGVGPTHWGVNEKSTCFAQANGYKGVYLCDPDNQYYRCEFARPDGRAKTNQMTPFNYQMDALSANWFTTQEAYRGYMNY… |
| A0A3F2RIA4 | 204-356 | None |
| A0A2P4YPA9 | 121-283 | None |
| M4BIX3 | 121-282 | None |
| A0A418DT14 | 180-348 | None |
| G4YLX0 | 1-128 | None |
| K3X0H4 | 168-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.