DPCstruct | MC37526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 811 ± 111 aa |
| Standard deviation of domain lengths | 110.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0CCZ4 | 1-821 | MKGMEESYESRYGGRGYKMIEEIIEESQLVGGAGGKSNMEEYEITGQPPPMQKYGIREEEPPIQDNGKQKGLRLIIYRVDNHQARSH… |
| A0A267GFP5 | 1-1018 | MDFITGLDVHVNAVRLIMSLHAGNQELGEPAVHPLVRTEDIRGEAVDSGVTHALLAHKQPVPRASPLPGMGAVLELQCRETSSRHLF… |
| A0A5D6XNY3 | 286-1002 | None |
| A0A177WGU5 | 1-835 | None |
| A0A5B8ML74 | 291-1186 | None |
| A0A6P7ZF76 | 533-1229 | None |
| A0A151PG00 | 1-696 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.