DPCstruct | MC37524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 222 ± 24 aa |
| Standard deviation of domain lengths | 24.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 76.90 |
| Assigned Pfam label(s) | CL0123- CL0229- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A267FTP2 | 26-237 | QNQGHSSTDKRLYDQMMKLLTFHLVCPKCSHCYQRVSKSGVFVFHCSCRNSFCPFCQSRQIGPHEDCQIKGLHVHHYRQCFFNLKHV… |
| A0A673CWP6 | 240-489 | FINDGDHLKVTCPSCRKSFCAQCKKPWEPQHQDLSCEQFQQWKRENDPEYQRQGLAGYLRDNGITCPHCRFQYALTKGGCMHFTCSQ… |
| A0A7R9AU56 | 2-174 | None |
| A0A267FVW3 | 293-533 | None |
| A0A7R9KV02 | 306-524 | None |
| A0A819W9F3 | 455-716 | None |
| A0A7D9LV24 | 136-401 | None |
| A0A444SK79 | 637-841 | None |
| A0A813ZU20 | 390-613 | None |
| S9XQQ4 | 600-854 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.