DPCstruct | MC37522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 216 ± 41 aa |
| Standard deviation of domain lengths | 41.04 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1TZB7 | 28-259 | MMNMGFLYAISPALDRLHAPGPAREAAYLRHLEYFNTNPYFSSIVMGVTLALEERLCKGEITEDIIHDTKEGLMTACAAIGDGLFWD… |
| Q8DR99 | 31-300 | MQNLGWAYTLIPAIKKLYTKKEDQIAALERHLEFFNTHPYVAAPVMGVTLALEEERANGVEIDDAAIQGVKIGMMGPLAGIGDPVFW… |
| A0A379XPC6 | 3-141 | None |
| A0A7C4FE92 | 108-355 | None |
| B8B2J4 | 907-1096 | None |
| A0A522BEI4 | 61-308 | None |
| A0A7Z0IPV3 | 267-523 | None |
| A0A1I0YJE0 | 6-205 | None |
| R6ZAM7 | 3-209 | None |
| A0A377LT57 | 48-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.