DPCstruct | MC37520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 286 ± 27 aa |
| Standard deviation of domain lengths | 26.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.09 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0060- PF03816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6KFR8 | 17-306 | KKGTDLTDSEKKRKLRAWSTVAGIALVVIQLVFTVLALLKLYKLNILPLKYVIIIDIVLVIIAIYNFASQFTKTHIIGKVLAVLLSG… |
| Q8CWU2 | 10-282 | SQKVKRSVNIVLLTIYLLLVCFLLFLIFKYNILAFRYLNLVVTALVLLVALVGLLLIIYKKAEKFTIFLLVFSILVSSVSLFAVQQF… |
| A0A3D4VS84 | 12-274 | None |
| A0A6G7WVR0 | 19-314 | None |
| A0A496KCV5 | 12-287 | None |
| A0A847PA05 | 48-377 | None |
| A0A832QEU0 | 3-324 | None |
| F5VSH3 | 2-233 | None |
| A0A7C6CA82 | 1-288 | None |
| A0A1Q9YLK4 | 83-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.