DPCstruct | MC3752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 463 ± 37 aa |
| Standard deviation of domain lengths | 37.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067CPJ0 | 1-482 | MVSSPWRDAYVAARRLSSCVAALVVLYIEVTGSIATRTALYGAAAPAELSNVYYSPLIGPFLRRVAANASYLAALAPTPHLNVLYID… |
| A0A6G0NSX0 | 3-532 | ETGFTNITDPPKPRSSLSKTAMSSIDNLLRPAEGTKEMQVFRLMHRLAVFTVAVLCVMISLESFSTAVVILRGQVSRDLPIEVYSAN… |
| A0A3R6VB48 | 1-499 | None |
| K3X070 | 3-443 | None |
| A0A1V9ZVX8 | 8-489 | None |
| A0A067CXB2 | 3-486 | None |
| A0A024U0S7 | 20-463 | None |
| A0A2D4BD74 | 2-478 | None |
| A0A421FIQ1 | 1-398 | None |
| A0A3R7JRS6 | 544-977 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.