DPCstruct | MC37517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 615 ± 82 aa |
| Standard deviation of domain lengths | 82.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 85.56 |
| Assigned Pfam label(s) | CL0689- CL0203- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S1BU94 | 222-817 | KTMADQFDLTIPATVIEMDSLTDVVGTHNKIVNYAFDFIRKNEKKKEGKLISEILNEEALTISAQASGKNTVKVNFIDGSSKELTFE… |
| A0A374G2A1 | 152-662 | DWQYLADTDEDGLPNLIEKEIGSDPYNPDTDGDGLPDGYEALTLGTDPTKPDTDDNGVLDCDEDFDEDGLTNLQEYEQGTEPYNEDT… |
| A0A1H9B9Q3 | 224-847 | None |
| A0A432DBX6 | 4-653 | None |
| A0A1E3KYT1 | 217-815 | None |
| A0A1M7Y9Y3 | 398-912 | None |
| A0A315XSV6 | 23-727 | None |
| A0A315Y2F4 | 105-693 | None |
| A0A3N1XGL4 | 148-957 | None |
| A0A0K8J6R2 | 333-920 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.