DPCstruct | MC37515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 129 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848LU80 | 7-132 | LTVNGVRLTPEAIQTFEAACGTRLSSGDYWYDPLSGLWGAWGGPAFNLPISPGLSLGGPLPFNASGGQSLVVVNGRALHPSEVLKLI… |
| A0A7C8ZY23 | 2-129 | YVNGHCIPQHLVEKAEKFAGTIEPGDYWYDSKAGFWGVMGHRCLGIIPPFIQEFGLAMPANCSGGDTTVYVNGRQLHRKDLNILVGR… |
| A0A453MPE7 | 99-233 | None |
| A0A5D2W9Q2 | 178-311 | None |
| A0A078I5W8 | 60-194 | None |
| A0A420N1D4 | 110-237 | None |
| A9T0U3 | 55-181 | None |
| A0A6D2L461 | 3-118 | None |
| A0A523DZK0 | 119-254 | None |
| A0A446NI94 | 473-609 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.