DPCstruct | MC37511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 84 ± 16 aa |
| Standard deviation of domain lengths | 16.47 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A494S0S2 | 54-129 | GITNPPIDELLKTASSKYALVIFAAKRARQINDYYQQIDEGMLEYVGPLVTPGIAEKPLSIALREINAGLLEHTEG |
| A0A848LBK1 | 1-73 | MARVTVEDCLPLVDNRFALVLLAAKRARQLMAGARPLIEQSKNKPPVLSLREVATGHVKFDRDVREALSGKYT |
| E4SFI5 | 1-72 | None |
| A0A399RIU6 | 29-118 | None |
| A0A1H3VJE5 | 10-78 | None |
| A0A7V5Y6Q1 | 1-100 | None |
| A0A2I1J6Q4 | 11-89 | None |
| A0A6L7SS89 | 1-104 | None |
| B4RCV5 | 141-221 | None |
| A0A7J5BV72 | 7-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.