DPCstruct | MC3751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.86 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D6YCA6 | 74-143 | AAEDAEGVLVFPSRGTSEFRYCLTLTKSGAIRIWLEDKGSKQQWESKDLALDEIVSEANAIPMMKLRDYF |
| A0A6G0NBU2 | 1-73 | MEDQQDLMVEGVTAFAPSPAASYRYVIELKGSKMSIRMEDRTSKKQWYKCDMAKTDYVSTANAIPDATVADYV |
| A0A6A3JSF7 | 2-70 | None |
| G4ZLM9 | 4-86 | None |
| A0A6A4CZH0 | 5-80 | None |
| A0A6A3LLX3 | 31-101 | None |
| A0A6A3JPW2 | 1-78 | None |
| A0A6A3Z8U9 | 1-83 | None |
| G4YLR4 | 1-75 | None |
| A0A329S313 | 51-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.