DPCstruct | MC37509
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 282 ± 57 aa |
| Standard deviation of domain lengths | 56.73 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05427 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444T4A5 | 3-289 | QRGVLETWGANMDLLISDVADNYRTFDMLEKLLPTPLRLAEDWTFQLHPSVQKYVIEKYYSFDGSVIREILGKKLSGRTRKDLDDVA… |
| A0A674GU71 | 7-297 | VFVGNTTLIDEEVYRLWLDGHSVAEAVARRLRGGVLEREGTSVAVLQSDTRDHYRTFQMLERLLHAPPRLLQQLLFQIPPERQALLI… |
| A0A674GYR3 | 177-481 | None |
| A0A183LH48 | 7-274 | None |
| A0A7R8X792 | 3-270 | None |
| A0A226ETU8 | 1-336 | None |
| A0A504Z4I4 | 233-520 | None |
| A0A183SNK3 | 4-334 | None |
| A0A1S3I7Q2 | 2-239 | None |
| F4WM87 | 1-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.