DPCstruct | MC37508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 92 ± 14 aa |
| Standard deviation of domain lengths | 14.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674GHS7 | 7-92 | LGEEFYREALEHCRSYNARLCAERSLRLPFLDAQTGVAQSNSYIWMERAHRRPGLSPGQIYSYPARCWRKKRRLNILEAPRLRPCE |
| A0A183EZI3 | 2-68 | MKNCSKWNSRVETERKGRYPVLDPQTGIAQHPSHHASYEISRRYPPTNSSQYCTYASRRWKKRKTAP |
| A0A0B1PJV5 | 2-77 | None |
| A0A674GXE2 | 147-243 | None |
| A0A498M4Q4 | 39-129 | None |
| A0A1I8HX33 | 25-101 | None |
| A0A158QF45 | 7-74 | None |
| H3B0B5 | 5-103 | None |
| A0A5B7ITE7 | 2-80 | None |
| V9LBI2 | 9-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.