DPCstruct | MC37506
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7T3N9 | 3-108 | LRPWLELHLETGDVPGLEWVDRSRSMFRILWKHRSKGNWTSLHGAVFVEWAKNTGRYSDNMDSRPNYAHLKTRLRCAINKAPDIEEV… |
| A0A674G8B2 | 1-129 | MAEGGPRRLRPWLLAQLQSGRYPGLQWDDAARTALRIPWAHGGRSGQYKVGACRQAWAEYKGRLRPGDPPDPAGWKTRLRCALARSP… |
| A0A834DEP3 | 4-126 | None |
| G3N7K1 | 1-138 | None |
| A0A498MPQ5 | 196-313 | None |
| A0A3M0J7F0 | 138-259 | None |
| T1FX01 | 1-116 | None |
| H0YV95 | 115-249 | None |
| A0A6I9Y9L0 | 52-162 | None |
| A0A7M7N5F7 | 56-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.