DPCstruct | MC37503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 93 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U7V0H8 | 19-117 | HPRKDIPMDELYIWVVQGSSASFPSAIFSSREKAVRWIEKYKISGILSKYPLDISIYDWAITQGLFKPKRDDQKTPGFIQSFSTVHI… |
| A0A6L6GG52 | 3-72 | LPSAVFTSFDLASDWIKSNYLSGILMEYPVDQSCYDWAIESGYFKEKSVIDRSPTFIEKFVSAYQQNWHF |
| A0A3A8RQ54 | 110-201 | None |
| A0A5D0US73 | 219-316 | None |
| A0A1Q3MLW2 | 2-85 | None |
| A0A4R4UCB7 | 40-155 | None |
| K0JZC7 | 18-110 | None |
| A0A1V4EMU5 | 4-101 | None |
| A0A1N6KG99 | 2-90 | None |
| W8F5U0 | 59-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.