DPCstruct | MC37500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 91 ± 15 aa |
| Standard deviation of domain lengths | 15.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z7LUQ6 | 1-95 | MYFYDNDVVEIAKNIKPSPRCELEITYINAEYLRRGKLKVGIFNRGTAWFDTGTTNSLMQAGQFVQVIEERQGLKIAAIEEMAYKMG… |
| A0A7C3M0S6 | 21-112 | LEITAINEAYLRQKKLKVKLLGRGYAWLDTGTHDSLLSASRFVQNIEERQGYKIACLEEIAYNNQWITKEDVLDISSKYSKNEYGKY… |
| A0A6A5L6B1 | 743-853 | None |
| A0A1Z8SG95 | 2-81 | None |
| A0A0U1HIE7 | 100-168 | None |
| W1F899 | 1-74 | None |
| A0A7Y7BIT2 | 1-67 | None |
| A0A7C7CDK1 | 117-207 | None |
| A0A2G8HTW2 | 95-183 | None |
| A0A433S8X2 | 111-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.