DPCstruct | MC3750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 79 |
|---|---|
| Mean domain length (aa) | 190 ± 35 aa |
| Standard deviation of domain lengths | 34.98 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4ZM09 | 2-127 | HTELYTWGEGFHRVPREFVLPPGTVRVVWQQWCAGQPLLRQLSKHDMASRLQKIRLAELQRLMRLVEALLTSDEVLRAHSSLDSAGL… |
| A0A6G0N8G8 | 7-195 | SGIAKLLDEKGIGTGAMRKEELESTIRNLLNAAGLYQRSSVQRESQPETCSGTIIYWQRDGKFHRLPESFEFPDVDALGVWHLWWFG… |
| W4GKP9 | 2-139 | None |
| W2YQN6 | 196-391 | None |
| A0A7S2VI60 | 190-434 | None |
| A0A3R6ZLW1 | 681-854 | None |
| L1IHQ8 | 269-503 | None |
| A0A5J4YFX9 | 304-491 | None |
| W4GP33 | 239-439 | None |
| W4GKC4 | 132-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.