DPCstruct | MC375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 195 ± 34 aa |
| Standard deviation of domain lengths | 33.83 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF03887- CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F5JQ90 | 13-183 | NIMEDIITLTAKERLSYALQLRILEKLSPDDDTLKNLKTAIEEGYTIHYQDLFEILSNELSLEDCRFVLDVLEMYRGLIFSALQINE… |
| A0A2V9PXB0 | 44-238 | HTPVSDGCKEQTGDPPRCVMKLSDGEKLILMVLADMYKHLEIKGEFDPDFISTTISGGHLWGLRWKYTHIPFEKSENPPEVSETVDI… |
| A0A5C8Z686 | 1-292 | None |
| A0A6I8MHL5 | 18-212 | None |
| A0A6N8U514 | 6-186 | None |
| A0A4Y7AHN2 | 122-327 | None |
| A0A1B1N395 | 1-184 | None |
| A0A1E3Z8I3 | 1-235 | None |
| A0A807CB56 | 22-185 | None |
| A0A290TE02 | 11-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.