DPCstruct | MC37488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 102 ± 16 aa |
| Standard deviation of domain lengths | 15.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6TJJ3 | 1-79 | NCGNLSSGVVPFALSAGLISAADGWHVFRLFNTNTQKLVDVGLRVVGGQAEVTGDLVLPGVSGTGAPVELIYPDPAGSR |
| A0A6A6HCK5 | 216-313 | DMSANCGNMTSAIGPFAIEAGLVSAGANGERVLKIHNTNTGKLIEAAFAVEDGEVVMKGDYAIDGVAGTAAKIRLAFVSPGGSKTGK… |
| A0A2H4SWA3 | 264-368 | None |
| A0A2A2M4E4 | 37-164 | None |
| A0A072P0B5 | 2-91 | None |
| A0A377XI32 | 6-98 | None |
| A0A6D0LY47 | 9-114 | None |
| A0A2J8G117 | 73-181 | None |
| G9NP53 | 3-117 | None |
| A0A1L9UEZ9 | 104-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.