DPCstruct | MC37487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 212 |
|---|---|
| Mean domain length (aa) | 174 ± 35 aa |
| Standard deviation of domain lengths | 35.27 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.03 |
| Pfam Score | 84.93 |
| Assigned Pfam label(s) | CL0192- CL0547- CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7U1R7 | 11-171 | CVLCNDTCPKECTGGVFDYNDPGKLTGCTVITTELRISSVPPNVNPSILNDLNDIREICGSLDISGFNKETFPYLSSLKTVGNDSTQ… |
| A0A8B6BK43 | 19-172 | AKECKTNNIDYINNSNLLKLSGCTKIIGNINVVEASFEGDPYLNIPALHPYQLDVFKSVKEITGVLVVQGKHKDFKDLSFLGNLTTI… |
| A0A016U4B2 | 3-162 | None |
| A0A368FRS1 | 1-127 | None |
| A0A3B3VWM0 | 92-275 | None |
| A0A183NUZ0 | 8-170 | None |
| A0A2H2HV52 | 74-217 | None |
| A0A1I7V1U1 | 31-184 | None |
| A0A5K4E9E6 | 331-519 | None |
| A0A0X3P6C2 | 351-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.