DPCstruct | MC37484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 130 ± 27 aa |
| Standard deviation of domain lengths | 27.41 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 28.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10376 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7TPQ2 | 65-182 | KTIDTSTYTSVASTSTGDHSKETLIELSKEKKQLMEKLQEKENKLQKLCLVKLYRTKNDLTQLEGLISKWRSVSQEAAQALLEHSPT… |
| V4AIL9 | 4-93 | LNEIKLKLSSSVSDKEEKLRKLKMVQMYRKKNDLSKLEVLIQKWRNVSQEAIRDLRQMLPEPKPSLHDLIQHLQIDIKLLKYNSESD… |
| A0A7M5X3J4 | 8-126 | None |
| A0A482WNA9 | 131-295 | None |
| A0A212CNE4 | 103-239 | None |
| A0A834FMF3 | 15-133 | None |
| A0A834P7S9 | 3-183 | None |
| B3RSJ0 | 146-268 | None |
| H2YWC1 | 53-175 | None |
| A0A3M7SLD1 | 49-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.