DPCstruct | MC37482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 249 ± 37 aa |
| Standard deviation of domain lengths | 36.76 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 64.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.99 |
| Pfam Score | 72.92 |
| Assigned Pfam label(s) | CL0023- CL0291- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3IA84 | 175-421 | SPIYTSDDYDKLLIVPLDAKDFRAKFDRLCASGAVPVYRQRVAIVGPYGVGKTHLVKRLLQEEYDEETDAYTPGVKIYRHRCIVHKD… |
| A0A1X7TWV8 | 38-266 | KALKEQGSADVAYARLMLLGSAGTGKTSLKRSLMEEPVNPHTTSTIVSDVSSVRPFGHKWQTRGNRWREATEEDELEEIARLFKSFN… |
| A0A1X7T3Y1 | 10-243 | None |
| A0A1X7T2W0 | 8-269 | None |
| A0A1X7T8L9 | 2-229 | None |
| A0A1X7SSY6 | 4-277 | None |
| A0A1X7T4M2 | 89-414 | None |
| A0A1X7SWA0 | 3-201 | None |
| A0A1X7T675 | 2-211 | None |
| A0A6J8EH05 | 158-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.