DPCstruct | MC37480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 173 ± 7 aa |
| Standard deviation of domain lengths | 6.88 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 31.61 |
| Pfam Score | 86.61 |
| Assigned Pfam label(s) | CL0020- PF13949 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3M5W7 | 1-180 | MVPMAVQQSMSVYSQRKAETVNRLVGTMREATNLCNGVLASLNLPAALEDLSGDSIPQSIVEKARAIVQQGGLQSIEQLIRDLPELL… |
| A0A1X7TJY1 | 1-164 | MSNYNSKKDALFNGELEKLRNATSSLNDLASKNLPAAIEDTGGNAVPDSIKEKSQGIREQGGIQSLEDKLYSLPELLTRNREILDET… |
| A0A507C9B5 | 536-715 | None |
| A0A158R2M2 | 315-484 | None |
| A0A2G5U9P1 | 372-531 | None |
| A0A7J8LW58 | 157-324 | None |
| A0A5B7AJN3 | 371-547 | None |
| W6VC02 | 200-378 | None |
| A0A0N4YUE1 | 44-214 | None |
| A0A813MV95 | 391-569 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.