DPCstruct | MC3748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 365 ± 86 aa |
| Standard deviation of domain lengths | 85.81 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 66.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2WKG8 | 1-280 | MQKRQRRIFQAAFDKDAMIVESLGDDPELLERFLSIRQTKHAPYNPVSAAIFTAPAATTPLAPPRRAETTSKFAFTPRTEQEFLHDQ… |
| A0A6G0MUJ7 | 191-552 | VDEAQLVPVFNIENTRVEYLPIEHILNFVSYFQGKRRAPQGASVPTALFTEPVGPPTAESTPLQSGSNDTAILQQLYDSDDDLVPID… |
| A0A081AV06 | 4-321 | None |
| G4ZKS8 | 90-461 | None |
| A0A6A3TKQ7 | 171-625 | None |
| A0A6A3TLZ3 | 1-250 | None |
| A0A6A3V941 | 12-513 | None |
| A0A662WGA8 | 49-407 | None |
| A0A080Z6C0 | 11-226 | None |
| W2YKH7 | 5-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.