DPCstruct | MC37473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 209 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7TGS2 | 2-191 | LEEYEEESDLKIRESLKKEFPDLTVPDQLIDKEYLKFSCDFFMSRGFSELPQVTVNGVVLELEDEDLQNAIVNEVQHQTSEIQQLVY… |
| A0A0J8R400 | 68-259 | KDSFNAAVQDREHHADRPKLTFEEILSSDHFEPTIITKTKAYLKRLSSDGPNPPMFVNGAIIPRDEHWMQPLVTRLAQDLEEIQQAI… |
| A0A833R6B8 | 166-385 | None |
| Q8BI80 | 3-219 | None |
| A0A3Q0KM82 | 373-614 | None |
| A0A1X7TPD0 | 75-266 | None |
| A0A7J9LVZ4 | 288-488 | None |
| A0A5D3DFV5 | 330-524 | None |
| A0A287F8K9 | 278-484 | None |
| E7F6G9 | 557-772 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.