DPCstruct | MC37472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 190 ± 23 aa |
| Standard deviation of domain lengths | 23.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7TGR0 | 1-166 | MAAISKSELIWSKRSCVSDPIKSIMCRVDLMSSSFLSSFKSDLFESPDNFALVRLQLTKSLYYKLLTLIITDEEKKQKLSTNKQLSI… |
| A0A833ZAK1 | 3-163 | NPMENIMKVVKEIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQETRRLHGVDMSVLLEQDIFHRSLMACCLEI… |
| A0A5C6N6V1 | 142-301 | None |
| A0A4Z2DE71 | 394-613 | None |
| A0A3L6VK94 | 2-142 | None |
| A0A7S1XE74 | 399-589 | None |
| A0A368F366 | 1-179 | None |
| R7U2C1 | 2-152 | None |
| B4DT45 | 351-534 | None |
| A0A0C2JEK9 | 389-606 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.