DPCstruct | MC37470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 210 ± 25 aa |
| Standard deviation of domain lengths | 24.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7TF60 | 27-214 | KVWDSMVVKAVFPSDKDACFKWFAKLAMWEEPDIEPETARRIFTENILNLTPSSLTDCGFRCFDRFFRMVNHNQSRLSKWNRTSFIT… |
| A0A7J8B7K6 | 52-246 | PQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFFESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRSY… |
| A0A132AFI7 | 474-679 | None |
| A0A3P7DRL4 | 9-226 | None |
| A0A3N4JI15 | 27-271 | None |
| A0A2G8LKV2 | 187-401 | None |
| A0A0M3HEX8 | 1-200 | None |
| A0A1Y3B799 | 37-237 | None |
| A0A183E859 | 351-579 | None |
| A0A822B400 | 167-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.