DPCstruct | MC3747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9BW56 | 2-66 | LHTLDVDGEVFAVWGHDDGTDYDWLSGPNPGYGFGTSGKNMPEEWHREQIRGFLAMIDPANGYMA |
| A0A2I0BL31 | 20-92 | AFTELAELTVDGETFIVRKSEPDGAFHYDWISGPNDGYGFSTSGRSTPVSNEHHKAAIRDFLSAVDPATGYLS |
| A0A2T0JXD4 | 219-284 | None |
| A0A542H9P2 | 11-80 | None |
| A0A1Q8M160 | 13-85 | None |
| A0A554QZM0 | 1-78 | None |
| A0A0Q7VWG0 | 8-78 | None |
| A0A4Q1KT38 | 186-254 | None |
| A0A7Y9YCC7 | 148-217 | None |
| A0A136PNZ3 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.