DPCstruct | MC37469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 111 ± 12 aa |
| Standard deviation of domain lengths | 11.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 98.51 |
| Assigned Pfam label(s) | CL0378- CL0041- PF19718 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7STA7 | 9-99 | SNLLPDVLDQRHASVILRAIKDLVVELEEFGIHLGLSNADIQEIKVNAPYEIRTRRKDIIIAWLETGTATRSALISALEDVERFDIA… |
| A0A1X7TF36 | 4-110 | LSGRTLTPSDLDKVVDLLEKYHFSLKSYFDLGLYLHLSYSTLVEIKENNRRDIRSCFKECLASWLSGADGVENPTIDKLIAALEEIG… |
| A0A1X7TRT0 | 4-108 | None |
| A0A1X7TSD7 | 1-117 | None |
| A0A1X7TSH9 | 4-127 | None |
| A0A1X7TSJ2 | 2-110 | None |
| A0A1X7TTQ8 | 1-115 | None |
| A0A1X7TUE4 | 3-98 | None |
| A0A1X7TWV8 | 760-877 | None |
| A0A1X7TWQ9 | 5-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.