DPCstruct | MC37464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 125 ± 16 aa |
| Standard deviation of domain lengths | 16.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SZQ8 | 2-120 | SATVDVNKAKRVINDVLVSHYADLNSLPKKGLSELANQLYTVCLVNNAVKEAPLMQECIDEFKASLSFKRTLPKVEEHCQKFLNSFI… |
| A0A1X7T8Y9 | 19-128 | GRGQDIETIKKKLGDVLQSRQVAFNNIFDLSMGSIANEFYQVGIITQDVHRSPTYDTIIRYFLASISIIGTQSEIEKECGKFLTALC… |
| A0A1X7TZD2 | 55-175 | None |
| A0A1X7TZX8 | 400-517 | None |
| A0A1X7SNG3 | 1-93 | None |
| A0A1X7SP76 | 69-196 | None |
| A0A1X7SP81 | 107-238 | None |
| A0A1X7STW1 | 191-323 | None |
| A0A1X7SWS8 | 92-192 | None |
| A0A1X7T146 | 172-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.