DPCstruct | MC37463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 11.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 55.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A418B1H7 | 114-205 | VRAKELTELYHGLKLPLRNVEERLEVLLHVKWTVKEFECALTKELMELIDREADMLNRGRPAQSVEGLRKRISNLFLQFIENPTFNP… |
| A0A3Q4HB78 | 293-392 | IETQNTIRARELRDLYNSISLTTVSQEQRLHFLMTLKHTVKEQECALTRDIVDLVDREVDLMTRGVKSAKLEGLRTRICTLLLQYIK… |
| A0A7S1QQ64 | 356-454 | None |
| A0A812WGR8 | 497-607 | None |
| A0A3Q1G8Y6 | 405-504 | None |
| A0A024G4P3 | 806-897 | None |
| C1E0T6 | 491-585 | None |
| A0A7S1GAU3 | 253-376 | None |
| A0A7S0VK68 | 334-467 | None |
| H2YGU7 | 180-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.