DPCstruct | MC37459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 381 |
|---|---|
| Mean domain length (aa) | 211 ± 49 aa |
| Standard deviation of domain lengths | 49.14 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.83 |
| Pfam Score | 96.17 |
| Assigned Pfam label(s) | PF02661- CL0123- CL0105- PF13776- PF13784 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6DCV9 | 19-194 | VLINKLGINDDSQFDDAERQLSELAVLDIEFEEPPYDLHYWCGLHGKIFGDLFDWAGEIRRIDISKGQTRFCTVSRIEIEANKIFMQ… |
| A0A496I0G9 | 34-229 | LAETISILTTEYIPREMPQRAFFEVKNYQNMLFFLLENLNKRQSVDSFFIRELHGILMNFLLPNKEVFKTTDNTILGASFETTPHFQ… |
| A0A847VFZ2 | 511-691 | None |
| A0A7H8YYN6 | 338-560 | None |
| M3UFK0 | 57-247 | None |
| H2J000 | 40-305 | None |
| A0A2T0PWV3 | 2-208 | None |
| A0A535A7B5 | 134-394 | None |
| A0A1V5GDN9 | 74-341 | None |
| A0A3M1TKH2 | 22-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.