DPCstruct | MC37456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 91 ± 5 aa |
| Standard deviation of domain lengths | 4.74 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 40.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2ST58 | 1-83 | MLTGTIENIKFTPIFSQKLKECRFDDDVNNFPSRCLVKKDGTKLAISKWVSPKRTRSYPYSRVYDTFMTSAIQKVTIIPLVKD |
| A0A2M7NCU7 | 7-98 | ITGVKYKVVLTENLKKIDIKSFDINEAPSACVITDNKHSFAISKWVSPKRTRSYPFERVYNTLQHISKKITVIPIVKDEGAKGDRDF… |
| A0A510E075 | 2-97 | None |
| A0A2N3PKQ0 | 1-86 | None |
| A0A510E5Y7 | 2-97 | None |
| A0A800DR42 | 7-97 | None |
| A0A7X4BB06 | 5-90 | None |
| A0A3N0ZVQ1 | 3-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.