DPCstruct | MC37454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 6.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7PRQ3 | 3-80 | MHVELQATCSALGYLEGNKYIKEPDCLETVKELIRFLRREDDTCDIRRQLGDAQILQKDLVPLVKQYHNDKPIFDAVI |
| A0A670YI63 | 5-88 | ELLATCSALGFLEGDTYHKEPDCIESVKDLIRYLRHEDETRDIRQQLGAAQILQNDLIPIIIQYPQDKELFDAVIRLMVNLTQP |
| A0A6A4VET4 | 9-98 | None |
| A0A3P7K5B6 | 8-94 | None |
| A0A154PJL0 | 122-205 | None |
| A0A6P4EVY0 | 1-90 | None |
| A0A7T8KIW7 | 1-90 | None |
| A0A1Y3EDU0 | 3-81 | None |
| A0A7R8UQ34 | 1-92 | None |
| A0A6A4J8S6 | 5-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.