DPCstruct | MC37450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 220 ± 37 aa |
| Standard deviation of domain lengths | 36.89 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01275 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T7PNL7 | 31-228 | TQKARDLLRNDKLLWFIEYTVTGIVVSMFVLGTCFMVAGHLSTDPTSRRVFNSTSKNRCGRGLNMFLLGFMYVLSLCWMLACTLLST… |
| A0A5B7EJ53 | 2-138 | MAQWQFMGITYLLTLAWLLMFAVLIIVTIFYTLAWFQCINVPSNECIDYNQFSFLFPHGTPEEEKRVCLGGKRKLFCKDYVNNAEIM… |
| A0A444U149 | 10-237 | None |
| V4CI47 | 19-181 | None |
| A0A0P7WNZ6 | 2-173 | None |
| A0A672FFB7 | 35-251 | None |
| A0A653D4A5 | 44-284 | None |
| A0A556U9T2 | 926-1161 | None |
| A0A498NAZ9 | 34-208 | None |
| A0A250WV00 | 16-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.