DPCstruct | MC3744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 133 |
|---|---|
| Mean domain length (aa) | 76 ± 10 aa |
| Standard deviation of domain lengths | 9.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A116L2Q9 | 2-54 | KYKHLKSGKIYKVLFTVIIESDLVPGVVYQSLSTGDIFVRPASEFYDGRFVLE |
| A0A425W067 | 98-176 | GEEREVLRGRVYRHFKGDYYLVEDVARYSETGEELVIYRKLYGDGSLWARPRELFLSPVDRKKYPDATQHWRFELQEIE |
| A0A1G2DFY6 | 80-156 | None |
| A0A1W1X6I1 | 1-66 | None |
| A0A6P1TRP1 | 4-83 | None |
| A0A7G5LPF1 | 81-184 | None |
| A0A164QE55 | 1-69 | None |
| A0A2G9MCP4 | 40-113 | None |
| A0A843FV80 | 12-104 | None |
| A0A6I4MSZ2 | 38-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.